PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A12G2376
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Trihelix
Protein Properties Length: 824aa    MW: 93729 Da    PI: 7.1306
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A12G2376genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix29.32.2e-091231821776
     trihelix  17 meerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsess 76 
                  ++ + +rgk ++ + +ev++++ ++g++r +k+   kw+n+ ++++k+ e+ek++++++ 
  Gh_A12G2376 123 VQVQPSRGKTRADKDKEVAEFLNKHGINRDAKTAGTKWDNMLGEFRKVYEWEKGEKERVG 182
                  5567789999*******************************************9866555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF561121.93E-17680814IPR011009Protein kinase-like domain
CDDcd001807.85E-14680815No hitNo description
Gene3DG3DSA:1.10.510.108.1E-9681816No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 824 aa     Download sequence    Send to blast
MGDNTTGDGT RKQTVPQQTQ QHFSASSPIE PLECVNPKKP RYFSSDKWKQ APMAESTQAR  60
VAAGSSSDTY SSPPHSPTII KPEGDQFQHQ LRKGKYVSPV WKPNEMLWLA RAWRIQYLGG  120
VGVQVQPSRG KTRADKDKEV AEFLNKHGIN RDAKTAGTKW DNMLGEFRKV YEWEKGEKER  180
VGKSYFRLSP YERKLHRLPA SFDEEVFEEL VQFMVPRDGR TVGSRALPMP PPVMTTSLLG  240
FDTALDGGLL SLHSSSSSKE LRRIGKIRMT WEESVTLWAE EGEHHRGRVK LQCSSFLNAD  300
ELIFFDDAMV GSTMEAFEDT PLKGFSVDTF VNGQQVKVFG RRKSAQHPFV EPSIRSMPPM  360
EFQDPTDFYM ACLRVPPTTL PSLFELSWHL QEPPPEDYRF PLRRDVYRDL PPGKEVMFTA  420
SSELLDCRAM VYDMLGPMIR TNTSLSAASA TDRDSFIGLW DDCINRVVSK FCSVEMVIIR  480
KPSSPSTDQP LQDRWPNVTG FVKNFCLWRG EETDRSREGQ LDPSSTIVEK LLWSYMDLPY  540
ILGYYAVGYM VTFCALSRSE DRVIMTDLYS VDLSFPSERL KALVPCYRIA GLLPLLADRC  600
LNRVLDMQVP FSDFERINLG NGDIIEMTPN TVTRSFSSKK KWAMVKEIYD MLDQRIPHAE  660
FIYRAAEIDS TLVFKPRGCK FKPLNYDQLV EALKYVTKAL VALHDLSFMH RDLSWDKVLR  720
RCDGENEWFV TGFDEAVGAP QIYPHPVAST EARGTHAPEM VRGLHGVKVD VWGVGHLVKT  780
CGLTNLPKML RELQSRCLDQ NPDQRPTAAD CYHHLLSASS TATY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012440232.10.0PREDICTED: uncharacterized protein LOC105765589
TrEMBLA0A0D2TE920.0A0A0D2TE92_G
STRINGVIT_16s0022g02290.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83561624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33550.13e-08Trihelix family protein